PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10025209m
Common NameCICLE_v10025209mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 601aa    MW: 65172.4 Da    PI: 7.4348
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10025209mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.84.6e-24232276145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  Ciclev10025209m 232 DPEPGRCRRTDGKKWRCSRDAVTDQKYCERHINRGRHRSRKPVEG 276
                      79****************************************985 PP

2QLQ50.85e-18164200137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q  +L++Q+l+yKy+++n+PvP++Ll +++k
  Ciclev10025209m 164 GPFTPSQRIELEHQALIYKYILSNAPVPSNLLIPLKK 200
                      59*******************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.6E-9164200IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.541165200IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-12165198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.057232276IPR014977WRC domain
PfamPF088791.9E-20233275IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDFGVLGLEG LSGLENGAPS QLSIYPETMP KAVGSSSRFV KKERSEPDEG DKPVSKMPKT  60
VDFSATKTLT LHQPTPLLRS NSLVSPDNNN TRNQHHEQML SFSSYKSQVP FLTTSTALME  120
RSSQQATAFP FYQHLPSSAH TRNTGYGYGS LNASMHGSFS GARGPFTPSQ RIELEHQALI  180
YKYILSNAPV PSNLLIPLKK SLHPFGLPYP ASYASNSYGW GTFHLGYSGN TDPEPGRCRR  240
TDGKKWRCSR DAVTDQKYCE RHINRGRHRS RKPVEGQTGH SNSKVVPTTS SVSTSVIANG  300
GVPNSLAISQ HELKNLQPVA ANPSADALVS RVQDSRSLSM MSSTINLKPN ESTFSFPKQD  360
FPWEESSQSV FGLVSSDSLL NPSQRSSYLN SKSYDESFLA FNDQETQDQN PLRQFIDDWP  420
KDESNRSVIT WPEELKSDWT QLSMSIPMAP PEFSSASSSP THERLALSPL KLSRELDPMH  480
TGLGMNGDLG EPNQKQTNWI PISWGSSMGG PLGEALANTS KNVNACKNSA LNLLTEGWDG  540
SPQLGSSPTG VLQKSTFCSL SNSSSGSSPI AENKKAPDGA NLCDDVVGSA LASSSSIPSL  600
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5504491e-46EU550449.1 Arabidopsis thaliana isolate CS6714 GRL1 (GRL1) gene, partial cds.
GenBankEU5504501e-46EU550450.1 Arabidopsis thaliana isolate CS6732 GRL1 (GRL1) gene, partial cds.
GenBankEU5504511e-46EU550451.1 Arabidopsis thaliana isolate CS6751 GRL1 (GRL1) gene, partial cds.
GenBankEU5504521e-46EU550452.1 Arabidopsis thaliana isolate CS6781 GRL1 (GRL1) gene, partial cds.
GenBankEU5504531e-46EU550453.1 Arabidopsis thaliana isolate CS6796 GRL1 (GRL1) gene, partial cds.
GenBankEU5504541e-46EU550454.1 Arabidopsis thaliana isolate CS6797 GRL1 (GRL1) gene, partial cds.
GenBankEU5504551e-46EU550455.1 Arabidopsis thaliana isolate CS6799 GRL1 (GRL1) gene, partial cds.
GenBankEU5504561e-46EU550456.1 Arabidopsis thaliana isolate CS902 GRL1 (GRL1) gene, partial cds.
GenBankEU5504571e-46EU550457.1 Arabidopsis thaliana isolate CS6810 GRL1 (GRL1) gene, partial cds.
GenBankEU5504581e-46EU550458.1 Arabidopsis thaliana isolate CS6824 GRL1 (GRL1) gene, partial cds.
GenBankEU5504591e-46EU550459.1 Arabidopsis thaliana isolate CS6885 GRL1 (GRL1) gene, partial cds.
GenBankEU5504601e-46EU550460.1 Arabidopsis thaliana isolate CS6896 GRL1 (GRL1) gene, partial cds.
GenBankEU5504611e-46EU550461.1 Arabidopsis thaliana isolate CS6922 GRL1 (GRL1) gene, partial cds.
GenBankEU5504621e-46EU550462.1 Arabidopsis thaliana isolate CS906 GRL1 (GRL1) gene, partial cds.
GenBankEU5504631e-46EU550463.1 Arabidopsis thaliana isolate CS931 GRL1 (GRL1) gene, partial cds.
GenBankEU5504641e-46EU550464.1 Arabidopsis thaliana isolate CS1602 GRL1 (GRL1) gene, partial cds.
GenBankEU5504651e-46EU550465.1 Arabidopsis thaliana isolate CS6182 GRL1 (GRL1) gene, partial cds.
GenBankEU5504661e-46EU550466.1 Arabidopsis thaliana isolate CS6603 GRL1 (GRL1) gene, partial cds.
GenBankEU5504671e-46EU550467.1 Arabidopsis thaliana isolate CS6608 GRL1 (GRL1) gene, partial cds.
GenBankEU5504681e-46EU550468.1 Arabidopsis thaliana isolate CS6626 GRL1 (GRL1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426135.10.0hypothetical protein CICLE_v10025209mg
TrEMBLV4SKJ80.0V4SKJ8_9R
STRINGVIT_00s0494g00010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-117growth-regulating factor 1